PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG031256.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 309aa    MW: 33801 Da    PI: 9.5579
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG031256.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.8e-1496140347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
      CCG031256.1  96 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 140
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.614619IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.99789145IPR017930Myb domain
SuperFamilySSF466896.06E-1791145IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-1792143IPR006447Myb domain, plants
SMARTSM007171.8E-1093143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-1195140IPR009057Homeodomain-like
PfamPF002491.8E-1196140IPR001005SANT/Myb domain
CDDcd001671.81E-996141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MMSRSCSQCG NNGHNSRTCG ESPCCGDQNV TPTGIMLFGV RVTEGAASFR KSASMINLSQ  60
YEQPHEEPNA DGAAGYESDD VVHASGRSRE RKRGVPWTEE EHKLFLLGLQ KVGKGDWRGI  120
SRNFVKTRTP TQVASHAQKY FLRRSNQNRR RRRSSLFDIT TDTFMISGGS SMEEDQVHQE  180
TPALALPQPQ PQPRLNNKRP EGLPMSTFPV ISPVTSPLSG DNPMEKLTLG QTNVDKLSPK  240
LIRPTPIIPI PPSSKLADIN LNQKGPKDQL TALSLKLSTP SSEEQSTPAS TRSSVFQAIS  300
SSDSIISVA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011043023.10.0PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B05e-54MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLB9HU850.0B9HU85_POPTR; DNA-binding family protein
STRINGPOPTR_0010s04860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.23e-76MYB_related family protein